Cat.No.
VC1456-102B
Species
Vibrio cholerae
Product Name
Recombinant Vibrio cholerae Cholera Toxin
Product Overview
Recombinant Vibrio cholerae VC1456 protein was expressed in E.coli.
Description
Cholera toxin (also known as choleragen and sometimes abbreviated to CTX, Ctx or CT) is protein complex secreted by the bacterium Vibrio cholerae. CTX is responsible for the massive, watery diarrhea characteristic of cholera infection. The cholera toxin is an oligomeric complex made up of six protein subunits: a single copy of the A subunit (part A, enzymatic), and five copies of the B subunit (part B, receptor binding), denoted as AB5. Subunit B binds while subunit A activates the G protein which activates adenylate cyclase. The five B subunits - each weighing 11 kDa, form a five-membered ring. The A subunit which is 28 kDa, has two important segments. The A1 portion of the chain (CTA1) is a globular enzyme payload that ADP-ribosylates G proteins, while the A2 chain (CTA2) forms an extended alpha helix which sits snugly in the central pore of the B subunit ring. This structure is similar in shape, mechanism, and sequence to the heat-labile enterotoxin secreted by some strains of the Escherichia coli bacterium.
Source
E. coli
Form
Supplied as a 0.2 μm filtered solution in 5 mM PB, pH 7.0, 75 mM NaCl, with 50 % glycerol.
Molecular Mass
Approximately 11.6 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
Protein length
103
AA Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Endotoxin
Less than 0.1 EU/µg of rCTB as determined by LAL method.
Purity
>98% by SDS-PAGE and HPLC analyses.
Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name
Official Symbol
Synonyms
Cholera Toxin; CT
Gene ID
Protein Refseq
UniProt ID
Figure 1
VC1456-102B, 1.jpg
Figure Title 1
SDS-PAGE of VC1456-102B
