Always Offer High-Quality Microbial Services For You!

Recombinant Serratia Marcescens HNS Protein (2-135 aa), His-tagged

Cat.No.
HNS-2131S
Species
Serratia Marcescens
Product Name
Recombinant Serratia Marcescens HNS Protein (2-135 aa), His-tagged
Product Overview
Recombinant Serratia Marcescens HNS Protein (2-135 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.
Description
H-NS binds tightly to ds-DNA, increases its thermal stability and inhibits transcription. It also binds to ss-DNA and RNA but with a much lower affinity. H-NS has possible histone-like function. May be a global transcriptional regulator through its ability to bind to curved DNA sequences, which are found in regions upstream of a certain subset of promoters. It plays a role in the thermal control of pili production. It is subject to transcriptional auto-repression. It binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (By similarity).
Source
Yeast
Tag
His
Form
Tris-based buffer,50% glycerol
Molecular Mass
17.5 kDa
Protein length
2-135 aa
AA Sequence
SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Purity
> 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration
A hardcopy of COA with reconstitution instruction is sent along with the products.
Official Symbol
Synonyms
hns; Histone-like protein HLP-II;
Gene ID
UniProt ID
Figure 1
HNS-2131S, 1.jpg
Figure Note 1
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Data Sheet
MSDS
logo 24/7

We are here to help you further your
development in the microbiology field.

SUBSCRIBE

Enter your email here to subscribe

Copyright © 2025 Creative BioMart. All Rights Reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x