Recombinant Serratia Marcescens HNS Protein (2-135 aa), His-tagged

Cat.No.
HNS-2095S
Species
Serratia Marcescens
Product Name
Recombinant Serratia Marcescens HNS Protein (2-135 aa), His-tagged
Product Overview
Recombinant Serratia Marcescens HNS Protein (2-135 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length of Mature Protein.
Description
H-NS binds tightly to ds-DNA, increases its thermal stability and inhibits transcription. It also binds to ss-DNA and RNA but with a much lower affinity. H-NS has possible histone-like function. May be a global transcriptional regulator through its ability to bind to curved DNA sequences, which are found in regions upstream of a certain subset of promoters. It plays a role in the thermal control of pili production. It is subject to transcriptional auto-repression. It binds preferentially to the upstream region of its own gene recognizing two segments of DNA on both sides of a bend centered around -150 (By similarity).
Source
E. coli
Tag
His
Form
Tris-based buffer,50% glycerol
Molecular Mass
19.5 kDa
Protein length
2-135 aa
AA Sequence
SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Purity
> 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration
A hardcopy of COA with reconstitution instruction is sent along with the products.
Official Symbol
Synonyms
hns; Histone-like protein HLP-II;
Gene ID
UniProt ID
Figure 1
HNS-2095S, 1.jpg
Figure Note 1
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Data Sheet
MSDS
logo 24/7

We are here to help you further your
development in the microbiology field.

SUBSCRIBE

Enter your email here to subscribe

Copyright © Creative BioMart. All Rights Reserved.