Always Offer High-Quality Microbial Services For You!

Recombinant Helicobacter Pylori DPS Protein (1-144 aa), His-SUMO-tagged

Cat.No.
DPS-2127H
Species
Helicobacter pylori
Product Name
Recombinant Helicobacter Pylori DPS Protein (1-144 aa), His-SUMO-tagged
Product Overview
Recombinant Helicobacter Pylori (strain ATCC 700392/26695) (Campylobacter pylori) DPS Protein (1-144 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length.
Description
Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.
Source
E. coli
Tag
His/SUMO
Form
Tris-based buffer,50% glycerol
Molecular Mass
32.9 kDa
Protein length
1-144 aa
AA Sequence
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Purity
> 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration
A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms
dps; Bacterioferritin HP-NAP Neutrophil-activating protein A Short name:NAP A;
UniProt ID
Figure 1
DPS-2127H, 1.jpg
Figure Note 1
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Data Sheet
MSDS
logo 24/7

We are here to help you further your
development in the microbiology field.

SUBSCRIBE

Enter your email here to subscribe

Copyright © Creative BioMart. All Rights Reserved.