Always Offer High-Quality Microbial Services For You!

Recombinant E.coli Beta-lactamase protein

Cat.No.
TEM-1-8922H
Species
E. coli
Product Name
Recombinant E.coli Beta-lactamase protein
Product Overview
Recombinant E.coli Beta-lactamase protein was expressed in E.coli.
Description
Beta-lactamases are enzymes produced by some bacteria and are responsible for their resistance to beta-lactam antibiotics like penicillins, cephamycins, and carbapenems. The lactamase enzyme breaks the β-lactam ring open and deactivates the molecule's antibacterial properties because of a common element in these antibiotics molecular structure: a four-atom ring known as a beta-lactam. TEM-1 is the most commonly-encountered beta-lactamase in gram-negative bacteria. Up to 90 % of ampicillin resistance in E. coli is due to the production of TEM-1. Also responsible for the ampicillin and penicillin resistance that is seen in H. influenzae and N. gonorrhoeae in increasing numbers. Based upon different combinations of changes, currently 140 TEM-type enzymes have been described. Recombinant beta-lactamase TEM-1 contains 264 amino acids residues.
Source
E. coli
Form
Lyophilized from a 0.2 µm filtered concentrated solution in 100 mM Tris, pH 7.0.
Bio-activity
Fully biologically active when compared to standard. One unit of enzyme activity is defined as the amount of enzyme which will hydrolyze 1.0 μmol of benzyl penicillin in presence of EDTA at pH 7.0 and at 25 centigrade.
Molecular Mass
Approximately 28.9 kDa, a single non-glycosylated polypeptide chain containing 264 amino acids.
Protein length
264
AA Sequence
MHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Purity
>95% by SDS-PAGE.
Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name
Official Symbol
Synonyms
Beta-lactamase protein
Gene ID
Protein Refseq
UniProt ID
Data Sheet
MSDS
logo 24/7

We are here to help you further your
development in the microbiology field.

SUBSCRIBE

Enter your email here to subscribe

Copyright © Creative BioMart. All Rights Reserved.