Always Offer High-Quality Microbial Services For You!

Recombinant Clostridium fliA protein

Cat.No.
fliA-324C
Species
Clostridium sp.
Product Name
Recombinant Clostridium fliA protein
Product Overview
Recombinant Clostridium fliA protein was expressed in E.coli.
Description
Flagellin protein FliA(H), also named RNA polymerase sigma factor for flagellar operon, Sigma F and Sigma-28, is belonging to the sigma-70 factor family or FliA subfamily. Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor controls the expression of flagella-related genes. May regulate the expression of genes involved in virulence.
Source
E. coli
Form
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass
Approximately 33.1 kDa, a single non-glycosylated polypeptide chain containing 302 amino acids.
Protein length
302
AA Sequence
MKGLKTGWIEKSVENIKTAYGIEPTGANKLKVTISDDGAYGVLASVTPKTGEFELHIDSSDFEKGDGESGNNIHGKLYDDRIIQHEMTHAVMNDALGIDKMNDLHDKNKLWFIEGTAEAMAGADERVKDIIGNDTQTGIDNTKLSKLATRADALLNGVSWNSSDEDYAAGYLMVKYIASKGIDLKAVMKEIKNTGASGLDNKIDLTNLKIDFKNNLENYIKDISKVHLDWDDDEKDVGSILGSDHGHGDIKAEDVVKGTTPEKEQPLDKFKIIWPDDNSDNTTGKIQLQVGANEGQSITILE
Endotoxin
Less than 0.1 EU/μg of rFliAH as determined by LAL method.
Purity
>97% by SDS-PAGE and HPLC analyses.
Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name
Official Symbol
Synonyms
Flagellin protein; Flagellin
Gene ID
Protein Refseq
UniProt ID
Data Sheet
MSDS
logo 24/7

We are here to help you further your
development in the microbiology field.

SUBSCRIBE

Enter your email here to subscribe

Copyright © 2025 Creative BioMart. All Rights Reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x